DPCstruct | MC35327
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 207 ± 22 aa |
| Standard deviation of domain lengths | 22.04 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 41.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817ZR25 | 460-703 | KVSPLIKLPTSLTFDILYREAVGQRFLVRFLEAMIEQDIEQAHLYEYYLFEGVWQGWARDYDFNKTRRSCMSALLDTKDWDIFDVQL… |
| A0A819UZ10 | 8-205 | YVYYLFEGAWQGWAHTQNFSKIRLKCMQTLLATKGWDLFDVQLLLDIPLIPRTNDGWLYRERRQLNFASTKKFNKVDGISFDTESGQ… |
| A0A817LR31 | 12-209 | None |
| A0A817IZW1 | 4-180 | None |
| A0A7R9QMC8 | 8-224 | None |
| A0A814RQJ4 | 3-198 | None |
| A0A820RXC8 | 235-483 | None |
| A0A815KJY2 | 16-189 | None |
| A0A816SYN9 | 9-218 | None |
| A0A817NQA7 | 538-752 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.