DPCstruct | MC3532
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 107 ± 11 aa |
| Standard deviation of domain lengths | 11.30 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 92.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N7B421 | 193-289 | INDEFYYNLRFRENDARLTPLMDVPALQGRPQQGNLVAWALQRVDGGRGFCATFNHFYSNWENPDYRKLLLNGLVWAAGAEVPATGV… |
| A0A7C6F1E1 | 1-127 | IDDEWYYHMRFVDDMKNVTPLLTAIPPDSTRERPDGPHSGNPTVRARKGMPEHVAWAYQRPDGGRGFGFTGGHHHWNWAHDQFRKLV… |
| A0A2E8B3F4 | 1-117 | None |
| A0A7X7YW27 | 211-299 | None |
| A0A3D4H7L2 | 1-117 | None |
| A0A3B9FKB3 | 911-1022 | None |
| A0A2E3RBT4 | 384-491 | None |
| A0A350QYF8 | 191-308 | None |
| A0A2S7TZQ8 | 177-287 | None |
| A0A2E3H8R2 | 49-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.