DPCstruct | MC35318
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 115 ± 16 aa |
| Standard deviation of domain lengths | 15.89 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 86.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.09 |
| Pfam Score | 77.94 |
| Assigned Pfam label(s) | PF05140- PF09923 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5XZN0 | 9-114 | SAWSGVRIKVTNRKTGASTTYDVPLGSPTKLGSSGLTLTADSFVPDFVMGADGITSRSPNPKNTAAHVVISEKGKPDFKGWLFGTMP… |
| A0A231UUI5 | 9-131 | MGGEVSEPAPAVEDRPVKNKVAVFTGIDKITGRIHHFDVYVDETVQFGALLVTPRVCINRPESLEPKTDSFVEIDEMTLDRKVRRIF… |
| V5SEQ9 | 39-166 | None |
| A0A660UQ54 | 59-166 | None |
| A0A1W7QWC6 | 2-101 | None |
| V4PK40 | 104-228 | None |
| A0A1N7L9G7 | 13-158 | None |
| A0A4Q3WQE5 | 39-170 | None |
| A0A6N8V052 | 1-118 | None |
| Q1N755 | 1-128 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.