DPCstruct | MC35317
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 141 ± 11 aa |
| Standard deviation of domain lengths | 11.15 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 25.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H6CHQ2 | 2-130 | ARLSEKDEQNILALITQWTNPKLGWVELVEACKAELGISVTRQALSTRQDFKMAIKDRKKALKAPSQAPGYVKDLKDANERIAKLEA… |
| A0A4R3U3C6 | 23-169 | ARRGARGRRVHISKADENIIRTIIEEWSRPEMGWEDVVEAVEQRLGRNWTRQALGSHSKIKLAFQHKKEELKNAKLGRKLRRSRVDA… |
| A0A7X6G6B3 | 1-133 | None |
| A0A5S9BQ53 | 1-147 | None |
| A0A7I8FQF1 | 4-127 | None |
| A0A5C2HF46 | 1-143 | None |
| A0A562KWL8 | 38-193 | None |
| A0A4Y9UJ57 | 8-137 | None |
| A0A085F862 | 50-208 | None |
| A0A4Z0EJ65 | 47-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.