DPCstruct | MC3531
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 177 ± 23 aa |
| Standard deviation of domain lengths | 22.95 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 89.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 16.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A519RJE2 | 96-279 | FIPPIGIVKSVFEGEYEYVLIKENFVAYGADENGIFEFELVLTKENLIDTFIKTIEFLPTIDGFWIYIKNYWESDLTELWVAKHFID… |
| A0A7C5W3F3 | 18-212 | GKFYFPIGIDMVEGENYRQSEAYEVSYLAEDDIPHYQYMVVVSIEKVAGMFEKLTEFLPDWVSVIVEVPAPGEHGLSMADVWISSPV… |
| A0A7V9QI92 | 10-159 | None |
| A0A1W9SE10 | 58-233 | None |
| R7ETX9 | 5-194 | None |
| A0A166W818 | 20-231 | None |
| B9XQ45 | 13-176 | None |
| A0A3M1DXJ5 | 6-199 | None |
| A0A7Y2H3Y4 | 25-183 | None |
| C7N5K1 | 6-169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.