DPCstruct | MC35308
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 189 ± 23 aa |
| Standard deviation of domain lengths | 23.47 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 16.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07589 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D5E487 | 5-182 | AATALALGSVANADIVYSDFTDTAQEGGSVSFEINGLDYEFGIQTGGPLNYAYVTTTSEGAGIFVPLLDEGNARNFAAGDNIGTLTS… |
| A0A1N6GXC8 | 22-192 | RNNTPKPKLERRSLQDKEVSYLHPQLINIDGDTLHDVYFVVGLINDSEGVHAKFAALAVKHAKLLSQPDSVIKLTKGEVIPVIPDHP… |
| A0A7W1T048 | 36-201 | None |
| A0A7W1YBQ6 | 2-168 | None |
| A0A3E1EQM8 | 21-233 | None |
| A0A3C1VCT1 | 9-185 | None |
| A0A1G7RNX7 | 20-189 | None |
| A0A7X7DGN5 | 12-188 | None |
| A0A4Y6KYW2 | 66-302 | None |
| A0A4S3LZV0 | 4-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.