DPCstruct | MC35306
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 74 ± 5 aa |
| Standard deviation of domain lengths | 4.57 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 90.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.14 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 71.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02445 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H5KRE0 | 210-280 | SESEIGCSLAEAAERKAYEAWLRKASATANSMHVVYINTSLVTKALSHSLVPTITCTSSNVLHTVLQAFAQ |
| A6GBP5 | 120-198 | SESAIGCSLAESAEALAYGAWLDQAANTPNSLHVVYINTSLRTKARAHHKVPTITCTSSNVVATVLQTFAQEPEAHVWF |
| A0A426ZBH0 | 1-71 | None |
| A0A383W510 | 312-378 | None |
| A0A6I9RPR4 | 225-302 | None |
| A0A0D9XYP5 | 204-281 | None |
| A0A7J0GAN0 | 291-359 | None |
| A0A0D6QRI5 | 72-138 | None |
| A0A2P6TPP4 | 337-412 | None |
| A0A0E0J955 | 375-452 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.