DPCstruct | MC35303
Metacluster Properties and Pfam Annotations
| Number of structural domains | 217 |
|---|---|
| Mean domain length (aa) | 192 ± 33 aa |
| Standard deviation of domain lengths | 33.45 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 14.90 |
| Pfam Score | 61.24 |
| Assigned Pfam label(s) | CL0193- CL0016- CL0191 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N9LNT6 | 200-388 | IGSIQLSGVSAAMQAKANALVASQAGNEFDTENSAPGLQRAFEDLYQDQGYAAVQVDVTEIDPPVVSNQAVEIPFTVAIREGGIYKL… |
| A0A2V6JTC8 | 29-232 | AEEKQKQQNVVAKEQEKHAQATTTVEFSGEQAFSEKDLRSAVKEQLATVDRYGLTPARADDLAFFVEVFYRKHGYTKASVHYKIENR… |
| A0A2X2SC06 | 35-231 | None |
| A0A6S7NKD2 | 189-431 | None |
| A0A7Z9N5U9 | 33-232 | None |
| A0A257SGJ5 | 29-234 | None |
| W4PK09 | 89-338 | None |
| A0A654M5P9 | 400-598 | None |
| A0A3A1MLL7 | 521-679 | None |
| A0A849TA93 | 16-184 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.