DPCstruct | MC35302
Metacluster Properties and Pfam Annotations
| Number of structural domains | 158 |
|---|---|
| Mean domain length (aa) | 149 ± 35 aa |
| Standard deviation of domain lengths | 34.97 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 81.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 21.60 |
| Pfam Score | 61.29 |
| Assigned Pfam label(s) | PF00707- PF14877- PF05198 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V6JAI9 | 13-132 | LSDALRKAQSLELDLVEVAANRKSSPAAKLKEIKFRVNIDEHDYLTKIRHGEEFLDRGNKVRVQLQFRGREMAHQEFGMQLMAKVKS… |
| A0A6C0W1R3 | 1-79 | MRYKIEEHDYQVRINQALRFLQASDKVKATITFRGREIQHVNLAIELLQKMAKDLEAVSEVQQSPSRDGKNMVMILTPK |
| A0A835XEU6 | 82-176 | None |
| A0A5P1ET27 | 215-379 | None |
| A0A819PNU3 | 35-171 | None |
| A0A2H6KBU6 | 788-1005 | None |
| A0A0D9VB13 | 20-143 | None |
| A0A3N7GFB0 | 10-110 | None |
| A0A6A7G646 | 51-206 | None |
| A0A1X2I9C6 | 115-276 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.