DPCstruct | MC35301
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 102 ± 9 aa |
| Standard deviation of domain lengths | 9.07 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1T3F4K5 | 1-121 | MTIASEEPAIESPLNTKADEYLKTDKFEVMSVETRVNNLKNIKVLLKTNQKSEKHIETIVKEIRAFYAPYKANINVFDTIEGMEKAD… |
| A0A3N7CPG0 | 152-248 | LDKESYEILETEHNRAVQNFHVLLKRAKFDKNYVYQFIKAFRKENCTMNCNVNLYDSKSVSNLIGVYPLEGKDYLKMADHLISASSF… |
| A0A829KQ36 | 8-95 | None |
| A0A1F6BCY6 | 168-271 | None |
| A0A7H8YVG3 | 7-103 | None |
| A0A101W9V2 | 105-208 | None |
| U6RBQ4 | 9-104 | None |
| A0A8B2Y3B1 | 450-554 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.