DPCstruct | MC3530
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 119 ± 5 aa |
| Standard deviation of domain lengths | 5.47 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 94.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1G5CP58 | 10-131 | PKAAAIDLMRCFPGSFINQRLELIVHPRTNQYFLLEDCHTGDDVVAKSVEWLSRAAAKGQPYDKERNNQAFRKMMQQGLNEFWGTDF… |
| J8L6C8 | 5-117 | VQSLVKKTQGCFPKAFVNSSNELIFDPRSNLSFRLEDVENHLDFLCKMFAWLSRPISKSLSDYKSRKILKSFNQLLGTNFTKKEMLL… |
| A0A373NQE7 | 2-124 | None |
| A0A3E0IPE0 | 2-111 | None |
| F9P1Q3 | 1-123 | None |
| A0A2N5IB79 | 7-120 | None |
| A0A373Q4Z0 | 3-125 | None |
| A0A2A6Z801 | 68-179 | None |
| A0A173WYL7 | 49-168 | None |
| A0A1C5P2I5 | 12-139 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.