DPCstruct | MC353
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 110 ± 21 aa |
| Standard deviation of domain lengths | 21.48 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 91.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 26.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF02623 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V1LJ33 | 12-124 | EYTQEHLINFSSGLFGFENLRNYLLIKIEEEIFFWLTSIEKPEIIFPLIGIRVIDDKYPEVIKHEAFGIVTLNSDLSKVTVNLKSPV… |
| A0A7V3WPE4 | 28-149 | VLHFPAGLLGFEQVKRYVLLGSREEAPFMWLQMVDEPRLAFLVIEPGYVVPDYAPEISDADVQALGLTRAEDAWVLNIVTVHPDGRA… |
| A0A3M1HKE4 | 135-259 | None |
| A0A7X9GAM2 | 2-73 | None |
| A0A257TQC3 | 50-179 | None |
| A0A1V5R0B4 | 28-129 | None |
| A0A3L7PR89 | 165-284 | None |
| A0A1F9BIB9 | 22-153 | None |
| S0EZL1 | 60-186 | None |
| A0A5J6LGL9 | 46-193 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.