DPCstruct | MC35298
Metacluster Properties and Pfam Annotations
| Number of structural domains | 143 |
|---|---|
| Mean domain length (aa) | 93 ± 17 aa |
| Standard deviation of domain lengths | 16.82 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 75.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 20.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0089 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847PZC0 | 6-106 | DEDILPEEKTPDLSSEDLVEVFDASSEMEALAIQSLLEAEGLEAAIRNLQMPWYDGLAKTLNPVWGKVLVRESQEREARRLIEDYMY… |
| A0A7C5DR31 | 36-103 | KGEMVVVAAFGRPIDAHLAKARLEADGIQAFLLDEQAISVNPFYAPALGGVKLVVRAEDAARAREILG |
| A0A518AK76 | 30-120 | None |
| A0A6G1A2W7 | 14-105 | None |
| A0A1W1X5G1 | 176-268 | None |
| A0A6B1GJQ7 | 17-125 | None |
| A0A7X6A9K1 | 10-92 | None |
| A0A2N2L7Z2 | 1-71 | None |
| A0A7V9V8B8 | 1-114 | None |
| A0A838RR81 | 2-70 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.