DPCstruct | MC3529
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 64 ± 4 aa |
| Standard deviation of domain lengths | 3.98 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 94.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 51.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0109 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2I0KSE1 | 77-140 | SDAEFAWLCVKHVKSNAIVIAKNNCMLGMGSGQPNRLESLRIAMKKSGEEVKGAALSSDAFFPF |
| A0A6H2F4D9 | 1-66 | MDDIIFGWKIIKFVKSKAIIYCKDNMTLGIGAGQIIDSIKLATIKAKERKFILKRSSIISDVFFPF |
| A0A2V7KKB4 | 101-163 | None |
| A0A7C4I6R6 | 389-450 | None |
| A0A645J1S1 | 22-84 | None |
| A0A6P4FXD1 | 192-266 | None |
| A0A812QQL2 | 115-176 | None |
| A0A2B8TRM2 | 30-90 | None |
| A0A7X2STU4 | 52-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.