DPCstruct | MC35278
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 84 ± 5 aa |
| Standard deviation of domain lengths | 4.50 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 32.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A423VBV1 | 413-489 | RGDAESRILDFAEQSNGKVQSQVAKPGIIAAPGRVLPTISGLPQVELSDIAAALLDQVANGLEKDTLYNDDLTRIGQ |
| W6Q654 | 1-94 | MVLKFPTENEGVEVCIARPGVIANPSTWSRALVANLFRIVGFFGRSLPNIQRSELAAAVLNQVMDGFEKEALLNADLVRIGQRELKF… |
| A0A6A5ZA81 | 476-559 | None |
| A0A225AEM9 | 462-548 | None |
| A0A094JEZ7 | 126-203 | None |
| A0A7S8D4C6 | 151-236 | None |
| A0A094AYL0 | 146-227 | None |
| A0A2J8DSU0 | 428-511 | None |
| A0A5N5LSX2 | 231-314 | None |
| A0A4Q4YA60 | 603-685 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.