DPCstruct | MC35274
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 404 ± 103 aa |
| Standard deviation of domain lengths | 103.00 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 76.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 16.69 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W6PPX9 | 27-376 | STHFKRFIEATLDQSDPSIVVQRIISSQSALKALQIGLRSNLTPVFINGYTAKLIQYLKNREVKLLCNGQFLEQLLLLIVEPRTLWG… |
| W6ZCH6 | 10-317 | RAAGLTKLFNAVIHGHRELKTASDGGRFLEALCAQEDASKCVECLVAAPGGLGAVAKAFRFSGDGAFLNGLASSVLLHLSQPSVKQL… |
| A0A6P8IC77 | 3-335 | None |
| G3J6R4 | 12-332 | None |
| A0A7R9P053 | 66-598 | None |
| A0A7E5X077 | 23-388 | None |
| A0A368G562 | 405-912 | None |
| A0A218YS12 | 10-370 | None |
| A0A2N0PJZ8 | 203-807 | None |
| A0A0K6FNQ3 | 8-587 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.