DPCstruct | MC35266
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 101 ± 11 aa |
| Standard deviation of domain lengths | 10.73 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 66.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.73 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 48.23 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A167FPL7 | 1-97 | MSPKQESKYYMVPNLRAIDPSAPEVDPSSYSWVQPIVIDDEDLMFGGKSLSAWYEEDRRRLSSGSDDGRAENSQDEEEKRGRERVRR… |
| A0A0B2WHV1 | 2-77 | TTSEDTYYFVPGLRSLDPLAREIDLKSHTWVRAMEIDDTDLTYEGKSLSSWFEDERSRRSSHSSHSSNDENDEEDK |
| A0A446BP20 | 1-102 | None |
| A0A175WHB3 | 1-108 | None |
| A0A084AZ12 | 68-164 | None |
| M1W8R7 | 19-114 | None |
| J5J4H1 | 1-114 | None |
| A0A395NEZ0 | 266-368 | None |
| A0A167VRQ5 | 27-134 | None |
| C7YJH2 | 2-97 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.