DPCstruct | MC35263
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 87 ± 5 aa |
| Standard deviation of domain lengths | 5.32 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.60 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6UHW6 | 71-152 | VLIRSTMHATTTRRGNTKKDPLGWHVTVSFKNATDQANGQHLTAHGYTKGSSNLELNSWTSDQNHKADTFQDYYGKEIWPTA |
| A0A166VWL3 | 78-162 | SGLHNTKSTGGGYTMDPQGWHLTMAFKDKEQEEREFHVASHGYTRGKDDFVLVNATHDKEKMDSTARGDKGSGKVVWPNEAELVE |
| M1VVB1 | 2-85 | None |
| A0A0J6FDG2 | 1-90 | None |
| A0A014MYF8 | 47-128 | None |
| A0A151GUW6 | 21-111 | None |
| A0A151GE78 | 1047-1147 | None |
| A0A0C9X0E3 | 1-84 | None |
| A0A1V6S392 | 7-92 | None |
| A0A0F4G4S8 | 2-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.