DPCstruct | MC35262
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 230 ± 30 aa |
| Standard deviation of domain lengths | 29.71 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A166VPT3 | 1-215 | MDTLRSPNRRPDAEALSIYELVRRQPRKRILIEPLLWTRLHLDILSCTFSQSNPAPQAMMHLPPIKNAFIVASRRRLFERHFFGLGQ… |
| A0A2H3SE44 | 1-197 | MPQSTFKSFHSLSVEHPDFATHPRFWTSHHLSVVKCSFQQVESENAHKPVILDTKQAEDMAECALALARDKFAERKGYKVDALLCNN… |
| A0A084RYQ2 | 16-300 | None |
| Q2GYX9 | 3-218 | None |
| A0A084AWQ6 | 1-259 | None |
| A0A5N6U673 | 8-257 | None |
| A0A094IBR3 | 111-341 | None |
| A0A3N2PKN7 | 5-309 | None |
| A0A094HQY4 | 1-211 | None |
| J4UQ26 | 14-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.