DPCstruct | MC3526
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 165 ± 32 aa |
| Standard deviation of domain lengths | 32.39 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 72.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 26.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484EAA6 | 2-145 | GASSEPGPDKAEPVISSAEMFEVVVAAVKAALHDPPHKACVATVAELYGDCAELYTIAHDTVAIAADLILAGKQRFPTLLSEEKGIL… |
| A0A484DZ77 | 2-158 | LETSAQPPALPSVSSSEMFTALVEEVAETLHSKPVQAWCATVRHLFAEVYNSVPVRSEELPAERKRFPSHKADEAGLLLNLFEQAHV… |
| A0A421FUU6 | 11-149 | None |
| D0N8D8 | 59-270 | None |
| A0A6A3T3R0 | 1-152 | None |
| G4ZE20 | 117-257 | None |
| A0A6A4AYK2 | 38-204 | None |
| A0A6A3Y449 | 93-298 | None |
| D0NRM2 | 51-257 | None |
| A0A6A3KSC2 | 142-280 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.