DPCstruct | MC35259
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 158 ± 24 aa |
| Standard deviation of domain lengths | 23.97 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 79.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 44.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0111 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P5MFB7 | 1-183 | MENLRLNTKEGGQRFVNIDTNFSVNKSVKEKVIRLHLLLTVKESAINVPQNLDARRRITFFANSLFMNMPKAPKVQNMLSFRNSALR… |
| A0A418FWG4 | 375-558 | MMLYEDAIKMLYWLEIGSAPDKSQDQKRQLLEDMVCLKFSYICACQVYGKHKAEGKAQATDMDYLLRTYPNLRVAFVDEAVDAANVK… |
| A0A2P5DIG4 | 435-575 | None |
| A0A1D1XCU9 | 191-349 | None |
| A0A6A3UIE4 | 154-314 | None |
| A0A0L9V9W1 | 445-633 | None |
| A0A453DH04 | 71-202 | None |
| A0A2N9INZ6 | 555-711 | None |
| A0A565C1Q6 | 1099-1276 | None |
| A0A453EUI8 | 4-112 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.