DPCstruct | MC35257
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 88 ± 7 aa |
| Standard deviation of domain lengths | 6.90 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 94.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 51.91 |
| Pfam Score | 85.71 |
| Assigned Pfam label(s) | CL0139- CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5FJ24 | 49-132 | TQEIIKGLPKSLKIVDLSADFRLRDISEYEEWYGQAHSAPELQKEVVYGLTEILREEIKGARVVANPGCYPTSVQLPLVPLIKA |
| A0A7R8ZS93 | 125-210 | TAMKMVPELLDRGVRVIDLAADFRLKDVAVWEQWYGMKHACPDLLGEAVYGLPEINREAIRSARLVANPGCYPTASALAALPLVER |
| A0A7X7DZK1 | 16-106 | None |
| A0A1V5LVE1 | 86-170 | None |
| A0A2Z6MI38 | 33-136 | None |
| A0A533YHF1 | 91-175 | None |
| A0A2I0QP30 | 1-81 | None |
| A0A1P8YGV8 | 85-171 | None |
| A0A812XZU7 | 341-412 | None |
| A0A447P2J8 | 59-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.