DPCstruct | MC35254
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 197 ± 29 aa |
| Standard deviation of domain lengths | 29.47 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 16.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A837ISQ7 | 3-167 | YTGDANNFSVDYIVSYSPYGLNDGAISGHVPYATFVKKTYDSESAAANDVPYQSSDSSSGLPTVDLGHGISGVMDSGAGQRYLQWNE… |
| A0A6N8I1W6 | 2-193 | LPTNIPVEKNRYLTATTVSQTLNYKVNFYETTKTAKINSPSVSKGTLIATLEGIKYKGTASAKASISDYVQINAADYDEFVDLGHRI… |
| A0A2T2X3H9 | 302-521 | None |
| A0A7X9N4H9 | 89-310 | None |
| A0A2K8N6G1 | 122-343 | None |
| D5WT54 | 124-340 | None |
| A0A0P9GQC9 | 214-386 | None |
| A0A2T2XEW5 | 6-148 | None |
| A0A2T2WXR8 | 86-300 | None |
| A0A2T2WJC2 | 194-438 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.