DPCstruct | MC35250
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 87 ± 8 aa |
| Standard deviation of domain lengths | 7.93 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 76.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 46.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H5RXH4 | 438-514 | IYGISQNPSTKNNYIIVLNQDKYFKIFCDKCGNKYANMEYKWCKVCQKNYLKENFASWTSNSEQIDKLIQEMQLKIN |
| A0A2H5RVB6 | 1-80 | MDEINESYGITQNPETNNYIMVLKDKCKKCNYTCNAIHIQQNFVNWTSGNNNIDKFIQDTQLLAHVRYKVFKTVLEWIPY |
| A0A372QJH4 | 210-301 | None |
| A0A015K9F2 | 130-206 | None |
| U9TXF6 | 272-360 | None |
| U9UZK2 | 350-442 | None |
| A0A2Z6RIX7 | 396-480 | None |
| A0A2Z6RHN5 | 83-173 | None |
| A0A2Z6RA37 | 471-559 | None |
| A0A2Z6R5Q5 | 802-898 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.