DPCstruct | MC3525
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 226 ± 30 aa |
| Standard deviation of domain lengths | 30.04 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V6W695 | 2-179 | VAAILPVYLVHYGPANFLWFSDIALVVTGIALWYESRLLASMMAVGVLLPELLWNVSFFSRLLAGVRVSGLADYMFDPAIPRWIRAL… |
| A0A484DWJ3 | 51-272 | KVGAFVALYTAMMVLSRFYEHGTYVLYEMLWGCNISLVLVVMALYFSKPFLVGVAMVTVSGDQLLWYLDFFSYIFCGKFIMGVMTYL… |
| A0A0V0QFH8 | 250-473 | None |
| A0A812JWZ9 | 234-478 | None |
| A0A2D5Z572 | 12-214 | None |
| A0A2V9GTA3 | 71-298 | None |
| A0A812LD82 | 1-216 | None |
| A0A7S2RIP3 | 45-308 | None |
| U6KWR0 | 120-358 | None |
| Q54T95 | 134-356 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.