DPCstruct | MC35248
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 229 ± 43 aa |
| Standard deviation of domain lengths | 42.57 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 75.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 24.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H5S0U7 | 1-159 | MSSTSSMSENSYEVFNEQLIKLNKKVDNMIEQNKQFNTKLIEENTIIKDVAKATFNISIYPTKEELREATEEFLKIRHQDFYNKFTT… |
| A0A2H5RBP9 | 38-299 | LRDGFLQIQKLKIENKIDTLSTEIQEFKSELKTLLSDKINLSSSVKESFIADVVKNVSKLLIKVSIYPTKDECCGAVEGYLSLNHAS… |
| A0A2Z6RGK1 | 35-237 | None |
| A0A397UFT7 | 75-329 | None |
| A0A397JA23 | 33-205 | None |
| A0A397JCY8 | 408-657 | None |
| A0A397UF61 | 22-293 | None |
| A0A397JGL1 | 1-245 | None |
| A0A397JGR6 | 74-273 | None |
| A0A397JIY6 | 4-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.