DPCstruct | MC35245
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 184 ± 26 aa |
| Standard deviation of domain lengths | 26.14 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 78.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 26.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H5R695 | 3-184 | SLYNELRIEIFKFVDTPISLALTNKKWYAISQDPQSRADWLIYKYGHAHALFHAVRLGNSFLTSEVLHSLLSKNAIISRYFIQRLLM… |
| A0A507F544 | 3-203 | RSHLPHEIWTRIFSLLDSSSPAAFSQACKAFYHISRDPHARAQYLLTRYGKQLALYSAFKWNRRVLSSNVGRLMRKRGAGLPRFLVQ… |
| A0A397SD37 | 7-155 | None |
| A0A397ULG3 | 26-212 | None |
| A0A507ERQ5 | 170-357 | None |
| A0A397JKA1 | 10-206 | None |
| A0A397SGK8 | 1-170 | None |
| U9TNP7 | 6-212 | None |
| A0A1Y2EM42 | 16-248 | None |
| A0A1C7M4K2 | 3-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.