DPCstruct | MC35244
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 124 ± 18 aa |
| Standard deviation of domain lengths | 18.34 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397ITN0 | 108-220 | TSIFEVCKVPPISIVAEASKISVWKKNPAISNSFRKLFDKVEEDEEDTYMTRIIKNVWPKKKNIPNLQIAWVISIAEIILNPNNENI… |
| A0A2H5R5T9 | 5-120 | FSIFGSRLPPINTNAGPSEVAKWKRKSEVKDCFEGLFKKMNPKDKNSSIVLASIIDKVLQGGNSNAELAYVLATCSTILNPHHDEIM… |
| A0A397JJA8 | 93-188 | None |
| A0A397JKU4 | 2-105 | None |
| A0A397JA23 | 98-209 | None |
| A0A397JVS3 | 1-96 | None |
| A0A397JSB2 | 176-289 | None |
| A0A397JIY6 | 89-219 | None |
| A0A397JB73 | 339-447 | None |
| A0A397JI04 | 2-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.