DPCstruct | MC35241
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 253 ± 52 aa |
| Standard deviation of domain lengths | 52.44 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 88.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 28.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11199 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X3NHK5 | 1-239 | MTIDKDALSKIAKVTLGHVVQEFPHSQARIYSSIDDFARPGLVHPIFFGSYDWHSCVHGYWLLLCLLDVELEQTQRHGIVELLDQQL… |
| A0A2N2GPX3 | 46-324 | PALTRALATKLAALPLACIGKPYPNKPGHVLASDAENLPHAQKTPIFHGCFDWHSSVHMHWTLVRLARLFPELPDRERILTLLDSQF… |
| A0A820UX07 | 32-311 | None |
| A0A522T676 | 64-370 | None |
| A0A0P9BD10 | 1-299 | None |
| A0A6T0UB13 | 45-365 | None |
| A0A257U7G4 | 15-277 | None |
| A0A821TWM0 | 29-318 | None |
| A0A815Z5Y6 | 2-275 | None |
| A0A0G4GGB7 | 12-271 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.