DPCstruct | MC3524
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 145 ± 15 aa |
| Standard deviation of domain lengths | 14.78 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D0P387 | 81-201 | DQAMVPTLPTKPVREAWPEQWQQMQSIWPSTASAPFPLEQSTEEEWILTARAEPTMLLHMIQRFAFPEELMASLSDKTLMEWTSQWR… |
| A0A484DTH1 | 7-157 | TDTEVPDRIDRDEWAAAWEILEPEWPNSKQIPFPTVNSQTSEWKRVASLAPDHLLWLVKRFMFPGELLQTLDDTIIETWMSGSRRDC… |
| M4B492 | 80-204 | None |
| K3WHA5 | 83-238 | None |
| D0NU92 | 614-734 | None |
| A0A225W3S3 | 393-549 | None |
| A0A6A4FUY2 | 576-731 | None |
| A0A6A3IIF0 | 6-168 | None |
| A0A6A3IBU7 | 224-378 | None |
| A0A484DTS8 | 1-147 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.