DPCstruct | MC35239
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 519 ± 83 aa |
| Standard deviation of domain lengths | 83.31 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 22.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B1BEL5 | 19-535 | AQQEINTSFKDEMNDIFQNLDKDKVPHGILLDFGMEFTNVKAFNGSLTDSTFINKIRLKEIYKTLLTSRVKNVSDGFVLPDDFDRNW… |
| A0A1T5GU66 | 18-559 | FIYGQQEVNTDWAAQANNLFSAIDKSKVPNGILLDYGMEFTNVPAFNGVLTDSTYVNSGNIREIYNTLLMSRIRDVSAGFVSPDTFH… |
| A0A1C3YD59 | 10-546 | None |
| A0A4Z0PNS7 | 1-661 | None |
| A0A2H0ISP6 | 7-547 | None |
| A0A848J751 | 220-836 | None |
| Q26HN7 | 6-500 | None |
| A0A180F0Q4 | 2-574 | None |
| A0A1M5CMB4 | 22-602 | None |
| A0A167X4P8 | 3-533 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.