DPCstruct | MC35235
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 93 ± 6 aa |
| Standard deviation of domain lengths | 5.68 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 72.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 41.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01548 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H9DP38 | 1-92 | MLGDREFPADRNGYQELLDWAASFGIINAFGVECTGSYGAGLTRHLIAAGIDVVEVNKGHSQVRHRGGKSDAVDAEAAARKVLTSSR… |
| A0A2G1PDL9 | 25-105 | LGDMQVAATPAGYSQLLDFATGLGQIQMIGIEGTGSYGAGLARALRAAGAPIREVIRPKRSQRRRGKSDRIDAYAAAQQAL |
| A0A7W1K0V2 | 32-122 | None |
| A0A1Z1WM49 | 12-106 | None |
| K0V4Z2 | 1-97 | None |
| A0A7J9YV28 | 1-103 | None |
| A0A4R5E1Y1 | 2-91 | None |
| A0A177YFR5 | 1-90 | None |
| A0A2L1UYU8 | 20-114 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.