DPCstruct | MC35234
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 113 ± 6 aa |
| Standard deviation of domain lengths | 5.77 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 81.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 55.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q9CCF0 | 550-657 | MGGHHSARPPRDLDSKIEWKALGSELLQDRKVILHTDSAKSYKLKLPGVLRDKVVHCKKRVKVNGKWQWQHPHYVRIVTHKLPGTKG… |
| A0A813APX2 | 262-368 | RRAPGPGAIRKSDWQPFAQRFLANRKVILHTDSARSYRLKLPGMVHDAVVHKKRKVKKNGKWIWLRPTFVRVAKHKLPDGNTVTCKA… |
| A0A812PAA4 | 260-378 | None |
| A0A1Q9CQE9 | 225-328 | None |
| A0A1Q9E5A4 | 1079-1196 | None |
| A0A812PBR7 | 766-872 | None |
| A0A812REC1 | 905-1022 | None |
| A0A1Q9F414 | 393-506 | None |
| A0A812YKL0 | 326-444 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.