DPCstruct | MC35232
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 183 ± 51 aa |
| Standard deviation of domain lengths | 50.96 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 69.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.31 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812W7J2 | 1-164 | MVQAAWQWAARTKNLRKSLIHGEEEARLVLTDKFEAQDVTTNEISMSGSIDIEDDSGFLLSNDVPNVDADEAALTNGTAATGASTGT… |
| A0A812P2J0 | 758-913 | MVEKAWQWAHKNNCLRKNEIHGEEEALLVLSDSYELLDQEGQELSMAGTIEMEDDSGFLLADELPSIKASHADIFAGKLASSSGSGG… |
| A0A812WVC4 | 1-136 | None |
| A0A812Z1S8 | 1-169 | None |
| A0A812II94 | 1-198 | None |
| A0A812N6W9 | 257-429 | None |
| A0A812MGD4 | 113-348 | None |
| A0A1Q9C3K9 | 1-158 | None |
| A0A812Q6R3 | 85-278 | None |
| A0A812XB60 | 1-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.