DPCstruct | MC35230
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 561 ± 87 aa |
| Standard deviation of domain lengths | 87.41 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 23.71 |
| Pfam Score | 94.68 |
| Assigned Pfam label(s) | CL0023- CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J2H7J6 | 2-426 | YFEKRFVAKLYEHRGIIIYDVDERRLLKASDLPRRMKAFKRSPPEVPEKRLFPEPIYRLALTKDQVEVLKLLERLYERPEKGTKRVV… |
| A0A812UN95 | 256-907 | DELPSASISRSSPRKLLIVSAKRGEWALQVAAEVSQSLRTKSSNNMFPQIASPSRWIWASFDKKSQGPPKMDQDAPQWHWVDIKNAD… |
| A0A1I8C298 | 18-689 | None |
| A0A4Q0YPI2 | 9-522 | None |
| A0A523BKA2 | 22-523 | None |
| A0A6N7EUS9 | 14-619 | None |
| A0A2T2UFH1 | 30-581 | None |
| A0A7R7GDE8 | 2-560 | None |
| A0A812PQV5 | 28-709 | None |
| A0A318N3T6 | 4-613 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.