DPCstruct | MC3523
Metacluster Properties and Pfam Annotations
| Number of structural domains | 175 |
|---|---|
| Mean domain length (aa) | 187 ± 31 aa |
| Standard deviation of domain lengths | 31.24 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.72 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 17.89 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4S9QK61 | 30-168 | NKADKLERQLQEDNHKTWGWVIYRCTYSSDKDWMDFMSRLNFHIQESLKLHNGLDMMESLDHHVLEDRALFEAANPITVREHFRQWV… |
| A0A168FD14 | 31-207 | DADNIERQMRQDGHRTWGWLIYRCTYASDEQWAAFMARLAHYMDATLAFHNGLDLKPSLDARVVEDPAAFDGAVPGTVRQHFRQWAA… |
| A0A0S7DH10 | 55-190 | None |
| A0A0S7E9L0 | 2-167 | None |
| A0A098DL01 | 20-197 | None |
| A0A366S753 | 6-225 | None |
| A0A366SA59 | 12-220 | None |
| A0A1L9PCG7 | 454-653 | None |
| A0A3D8QRT6 | 8-202 | None |
| A0A3D8RA26 | 281-481 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.