DPCstruct | MC35229
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 248 ± 26 aa |
| Standard deviation of domain lengths | 26.28 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A812UFD5 | 1-246 | MQFCRDGSSVSLKDAMKSIQASSFESKEIRGSKKPGPRALEVPYKGSVLTGDALRAQVELWVRRGVIELDTGAALNLVAGSSDWLDL… |
| A0A8B4RVA3 | 3-204 | KIKDQPFEQFILKGKGDATIEPWFIPYQGQKLQGDALLQQIDLWEQQKVIEPTHAKALRLLNQHPEWFDLSNRTMVLFGAGSEAGPL… |
| A0A7S4LLK6 | 82-352 | None |
| A0A6A7FV70 | 385-670 | None |
| A0A0W1KIP0 | 343-566 | None |
| A0A812UW87 | 364-612 | None |
| A0A7S3WEI5 | 144-394 | None |
| K0ZE88 | 42-251 | None |
| A0A1F9IMC3 | 110-376 | None |
| A0A6B2KYF3 | 284-564 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.