DPCstruct | MC3522
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 195 ± 16 aa |
| Standard deviation of domain lengths | 16.41 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.81 |
| Pfam Score | 95.83 |
| Assigned Pfam label(s) | PF02755- CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J8EE36 | 1-165 | MPNEVLLDILGFLDVNDLLSISRISHHLRTLSMAPILHAYRLRLNRAILPPLLATRPPLADLIARSIFLTNTTVVSRRLGRSLVSIR… |
| A0A168D530 | 42-231 | ARDPLCEAPVTDSGCIDCLPNEVLIHVLQFLDVSDLLATSRTSHLLRSLSLSPILHHDRLRRARQTLPPLLSSPGRPTLADLISRSI… |
| A0A2T3AIA9 | 137-321 | None |
| L7JQG7 | 173-354 | None |
| A0A0J9XA99 | 24-204 | None |
| A0A5N5QL93 | 1-196 | None |
| W6MP03 | 1-215 | None |
| A0A381LJW7 | 2-191 | None |
| A0A1L7X4J8 | 12-200 | None |
| A0A072NV41 | 1-200 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.