DPCstruct | MC35210
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 80 ± 6 aa |
| Standard deviation of domain lengths | 6.17 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 91.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 54.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6N6XAN9 | 95-168 | MSWRDAPRELSFRRFFEVTGLVGMRVEDEAVFQDTHRLILELVRSGAVDGLRIDHVDGLADPKSYVEKLRQEAG |
| A0A509D3B9 | 1-85 | MSWRDAAHSLSYRRFFEVTGLVGMRVEDKTVFDDTHRLILELVRTGAVDGLRIDHIDGLADPKAYLERLRQEVGRRAISPWKNSR |
| A0A2V6QTL2 | 140-213 | None |
| A0A1A9GC89 | 129-215 | None |
| A0A1Z1WLF9 | 90-175 | None |
| A0A2V8HSD1 | 70-150 | None |
| A0A4Q2Y5U5 | 1-89 | None |
| A0A843YAE5 | 7-75 | None |
| A0A7Y5K5E2 | 1-74 | None |
| A0A4R5JBS8 | 1-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.