DPCstruct | MC35206
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 58 ± 8 aa |
| Standard deviation of domain lengths | 7.54 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 79.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A827F8D7 | 49-106 | IAPEDWLRAEMQGEIVALVHSHPGGLPWLSEADRRLQIKSALPWWLVCRGDIHKFRCV |
| A0A4P0YN25 | 1-70 | MLPEDWLRAEMQGEIVALVHSHPGGLPWLSETDRRLQVQSDLPWWLVCRGAIHKFRAVCHIFPGGALSTG |
| A0A244B919 | 1-58 | None |
| A0A447XGL8 | 1-60 | None |
| A0A8B4L745 | 1-58 | None |
| A0A376FXN5 | 1-58 | None |
| A0A192CNB6 | 49-106 | None |
| A0A376DL64 | 1-43 | None |
| A0A377CF06 | 284-343 | None |
| A0A377LDB6 | 1-44 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.