DPCstruct | MC35204
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 105 ± 13 aa |
| Standard deviation of domain lengths | 12.75 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 90.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 27.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0348 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A855SQ38 | 1-77 | MQHLKNIKAGNPKTIEQYQLTKEFDVVWLYSDDGRNWYEEQKNFQPDTLKVAYNQEGIICCIEKDASLINPEGMSVI |
| A0A509C441 | 1-87 | MMHLKNISVGNPKTLEQYQLTKRSGVIWLYSEDGKNWYEEQKNFAADTLKIACDQNGVIVNISKDVSTINPTGLSVVELYDITANRR |
| A0A2A3WYS4 | 1-109 | None |
| A0A1A9WW69 | 1-110 | None |
| A0A377BDC4 | 1-119 | None |
| W0BUG4 | 809-911 | None |
| A0A509B2M6 | 1-87 | None |
| A0A4Q7FYS6 | 5-118 | None |
| A0A484YWY3 | 1-112 | None |
| A0A4R2GRL5 | 3-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.