DPCstruct | MC35202
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 78 ± 7 aa |
| Standard deviation of domain lengths | 6.83 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 57.35 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A376KW69 | 66-141 | VAPLTSMFLFGPNQPSPANNYRPELHDSNGLSIHAGNGEWIWRPLNNPKHLAVSSFSMENPQGFGLLQRGRDFSRF |
| A0A509BZT5 | 1-73 | MGKLGVAPLTSMFLFGPNQPSPTTNYRPELHDSNGLSIHAGNGEWIWRPLNNPKHLAVSSYAMENPQGFGLLQ |
| A0A6M1I4P7 | 54-137 | None |
| A0A7X3U039 | 275-344 | None |
| A0A3M5YZ86 | 261-349 | None |
| A0A447XFZ8 | 13-85 | None |
| A0A3S4I022 | 162-236 | None |
| A0A655X0X0 | 117-200 | None |
| A0A2X2I443 | 196-286 | None |
| A0A376UC30 | 1-72 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.