DPCstruct | MC35200
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 91 ± 13 aa |
| Standard deviation of domain lengths | 13.07 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 72.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 48.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09806 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7A8R3 | 2-89 | ETVDIQAVESKLSDVTVTAIPMIPKALQNQQPGQSKYAQLLGVIEEMGREVRPTYAGSRSSAERLKRGIVHARILVRECLIETEKSAR |
| A0A7J7W6A2 | 1-65 | MKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART |
| A0A7J5YT31 | 33-130 | None |
| A0A2T7PXV6 | 44-144 | None |
| A0A6I8P0J5 | 115-200 | None |
| A0A4W2GFE8 | 178-279 | None |
| A0A3Q0EG37 | 13-86 | None |
| T1KXJ2 | 34-125 | None |
| Q6DHQ0 | 11-110 | None |
| A0A0K8TST7 | 71-160 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.