DPCstruct | MC3520
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 140 ± 13 aa |
| Standard deviation of domain lengths | 13.23 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 73.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 35.34 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| X0L046 | 5-134 | SNAAAECGALGVAEWDLDTLPAGMDVSELRKCKEHPLSVKIHSRNPDSTKVNVLEKRKCTSSKWKPKAGCDKHWCWQNCGSAKEVEW… |
| A0A167Z5W7 | 53-198 | DSEVLDRVEEDPEHFTHPYPHEHDTHCGELGVMRIDKSELPKGVDPQKVRKCLRHPEAIRLKLKTDHDMNLFEREWFTAGKFACSKH… |
| A0A135TGW4 | 1-140 | None |
| A0A5C6SV93 | 20-143 | None |
| A0A2V5IKQ9 | 2-150 | None |
| Q5ATQ5 | 1-158 | None |
| A0A2U3ED88 | 2-128 | None |
| A0A4Q2W7P3 | 1-117 | None |
| A0A2A9P6N8 | 58-182 | None |
| A0A430LUU4 | 79-227 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.