DPCstruct | MC352
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 122 ± 14 aa |
| Standard deviation of domain lengths | 14.08 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 77.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.56 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 24.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B7NZP9 | 5-114 | AKCLGQRSGFIKRSADELARFTKMAWNLDALSVPYKPYHLLDFTDQNTIAGCKTMSDRAVGGYSTASLDYVPADPATNTPAHARFHG… |
| A0A1X7USA0 | 1-104 | MAKLVRSSLRSYVEGVKKAIALKPLDDSEKLMLWDLRDEDCVNEWECISDEEKGGGSKATFKSNKKGTGSVFEGVLNTSIKNTELKY… |
| A0A3P7DR66 | 717-840 | None |
| A0A1P8APK0 | 3-113 | None |
| A0A6J0TTI1 | 33-167 | None |
| A0A6J8A8S2 | 14-149 | None |
| A0A232ELE8 | 14-158 | None |
| C0NQ39 | 2-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.