DPCstruct | MC35196
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 61 ± 7 aa |
| Standard deviation of domain lengths | 7.04 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 74.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 84.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6ZDR5 | 110-167 | TFDTMWKPRQIGSKTLTFEMIVEKKILKIEDMSGNEVYLGWESVSEVWSLESVLRYRL |
| A0A7J6Z210 | 63-127 | FDTMWKPRQIGSKTLTFEMIEEKKILKIEDMCGNEVYLGWKSVSEVWSLESVLRYRLSYSSGSNF |
| A0A7J6ZHI4 | 100-173 | None |
| A0A7J7A526 | 22-77 | None |
| A0A7J7A4Q2 | 1-54 | None |
| A0A7J7A2D8 | 2-80 | None |
| A0A7J6ZXW4 | 216-271 | None |
| A0A7J6ZWC7 | 1-60 | None |
| A0A7J6ZR00 | 212-276 | None |
| A0A7J6YJG6 | 208-263 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.