DPCstruct | MC3519
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 107 ± 8 aa |
| Standard deviation of domain lengths | 7.68 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 33.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J9RPZ9 | 6-112 | STHNAISAYFIGPKAENLDNFRGNVDIILDELKRARLRYARRNEDPDFISDDAKMSAEYRQVSAKFQKAVRNTAKLLGKHSVPFWSP… |
| A0A2I2GMI9 | 8-110 | HQAISAFFIGPHAENMYFFRKHITVILDELESARQSYAPNDKRAITTKTQVSPQFAYFSSGISEAIRSATKLLSKHSIPYWSPRYGA… |
| A0A4S8KL41 | 2-102 | None |
| A0A1S8A771 | 1-119 | None |
| B8FAM3 | 25-124 | None |
| A0A353RY90 | 4-100 | None |
| Q0CZA7 | 4-111 | None |
| A0A2T3ZWB2 | 1-116 | None |
| A0A165AX88 | 12-129 | None |
| A0A351C6H5 | 15-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.