DPCstruct | MC35185
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5770 |
|---|---|
| Mean domain length (aa) | 212 ± 50 aa |
| Standard deviation of domain lengths | 50.25 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 85.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.43 |
| Mean intra-cluster sequence similarity (%) | 14.43 |
| Pfam Score | 95.69 |
| Assigned Pfam label(s) | CL0442- CL0288- CL0219- PF01221- CL0174 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0Z8J444 | 5-219 | LITGASGGLVQEMVPLLKDDFLILLGRDVEKIEQLYAYHEKKAVFDVDIRDEEALTAFFDQVDSQFGQIDILVNNAGYAIYDDFETF… |
| A0A843ZFK1 | 2-149 | LTGATGHLGTHITNQAIANHIDHFHIGVRNVEKVPEDWRGKVSVRQLDYFNQESMVEAFKGMDTVVFIPSIIHPSFKRIPEVENLVY… |
| A0A1I2KBL7 | 3-144 | None |
| A0A171JXL7 | 2-159 | None |
| A0A7R9KKP0 | 40-284 | None |
| A0A7R9L5A7 | 3-194 | None |
| A0A7R9KXL3 | 311-497 | None |
| A0A7R9KQV6 | 74-225 | None |
| A0A7R9KP27 | 5-221 | None |
| A0A7R9KMW0 | 4-246 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.