DPCstruct | MC35178
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 143 ± 16 aa |
| Standard deviation of domain lengths | 16.09 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 23.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V8L1Q5 | 1-108 | MSQLMVDVIYPTSDDIFYIVTRPPSNEAQWTAIQRSALTLAESANLLMMPGRARDQDKWMTDARLLLDAGNLAFKAAKAKDFDALVA… |
| A0A5E7Y8R0 | 208-339 | AGAAGSVETTRYATDLPLKTVMRAVFGHAAQEIWKRQGYVSDATGVHSLFPKDAEEWTLAENDALSLAEMTNILLLPGRRVDEQAWI… |
| A0A4Q6G5Q6 | 1-138 | None |
| A0A3N5GPL5 | 146-315 | None |
| A0A4Q5Y1Z2 | 1-127 | None |
| A0A258GVU6 | 9-133 | None |
| A0A355B5B4 | 1-139 | None |
| A0A3L6LZS6 | 16-176 | None |
| A0A841HT03 | 15-143 | None |
| A0A2E0Z2I0 | 21-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.