DPCstruct | MC35174
Metacluster Properties and Pfam Annotations
| Number of structural domains | 39 |
|---|---|
| Mean domain length (aa) | 385 ± 84 aa |
| Standard deviation of domain lengths | 84.33 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 84.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4R8TBG3 | 304-770 | MLLTIMELWVACDKAAVHAHPLLADYDPGVPRGLFQNLLLQSRRQMERLLRIEQYLMDRSSECNSLLPAFHIYKSFGASDTFAVRYF… |
| L7IRB3 | 4-306 | QATVFELCVPVPFSEWRDITTFILLDVLKCQYGKISIGRQEQSLGTYPALSKFRAPSCADQRIGLESSTKPSARTHRVRKPVPNLEI… |
| A0A7S8D6T4 | 244-580 | None |
| A0A1R3S0P5 | 8-302 | None |
| A0A833SSU0 | 29-507 | None |
| A0A1V8S7Q9 | 140-603 | None |
| A0A5N6E6D4 | 2-354 | None |
| A0A420H8R7 | 2-280 | None |
| A0A0C3AR72 | 306-779 | None |
| A0A6A4H2U9 | 103-403 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.